SCOPe 2.08: Domain d2ezxb_: 2ezx B:

Lineage for d2ezxb_ (2ezx B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family)
   contains one classic and one pseudo HhH motifs
   automatically mapped to Pfam PF02961

5. Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (2 proteins)

6. Protein Barrier-to-autointegration factor, BAF [47800] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47801] (24 PDB entries)

8. Domain d2ezxb_: 2ezx B: [17979]

Details for d2ezxb_

PDB Entry: 2ezx

PDB Description: solution structure of human barrier-to-autointegration factor baf, nmr, regularized mean structure

PDB Compounds: (B:) barrier-to-autointegration factor

SCOPe Domain Sequences for d2ezxb_:

Sequence; same for both SEQRES and ATOM records:

>d2ezxb_ a.60.5.1 (B:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl

Timeline for d2ezxb_:

• d2ezxb_ first appeared (with stable ids) in SCOP 1.55
  
• d2ezxb_ appears in SCOPe 2.07