Lineage for d2ezxa_ (2ezx A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4264Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 4332Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) (S)
  5. 4333Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (1 protein)
  6. 4334Protein Barrier-to-autointegration factor, BAF [47800] (1 species)
  7. 4335Species Human (Homo sapiens) [TaxId:9606] [47801] (5 PDB entries)
  8. 4344Domain d2ezxa_: 2ezx A: [17978]

Details for d2ezxa_

PDB Entry: 2ezx (more details)

PDB Description: solution structure of human barrier-to-autointegration factor baf, nmr, regularized mean structure

SCOP Domain Sequences for d2ezxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezxa_ a.60.5.1 (A:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens)}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl

SCOP Domain Coordinates for d2ezxa_:

Click to download the PDB-style file with coordinates for d2ezxa_.
(The format of our PDB-style files is described here.)

Timeline for d2ezxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ezxb_