Lineage for d3haka_ (3hak A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635622Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1635623Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1635624Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1635688Protein automated matches [191016] (6 species)
    not a true protein
  7. 1635693Species Human (Homo sapiens) [TaxId:9606] [188783] (8 PDB entries)
  8. 1635694Domain d3haka_: 3hak A: [177343]
    automated match to d1fkca_

Details for d3haka_

PDB Entry: 3hak (more details), 1.8 Å

PDB Description: human prion protein variant v129
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d3haka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3haka_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyq

SCOPe Domain Coordinates for d3haka_:

Click to download the PDB-style file with coordinates for d3haka_.
(The format of our PDB-style files is described here.)

Timeline for d3haka_: