PDB entry 3hak

View 3hak on RCSB PDB site
Description: Human prion protein variant V129
Class: membrane protein
Keywords: Prion protein, Cell membrane, Disease mutation, Disulfide bond, Glycoprotein, Golgi apparatus, GPI-anchor, Lipoprotein, Membrane, Polymorphism, Prion, MEMBRANE PROTEIN
Deposited on 2009-05-01, released 2010-01-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major prion protein
  Species: Homo sapiens [TaxId:9606]
  Gene: PRNP, PRIP, PRP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04156 (0-102)
    • variant (4)
  Domains in SCOPe 2.04: d3haka_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hakA (A:)
  lggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
  kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyq