![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
![]() | Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
![]() | Family d.6.1.1: Prion-like [54099] (3 proteins) |
![]() | Protein automated matches [191016] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188783] (10 PDB entries) |
![]() | Domain d3haka_: 3hak A: [177343] automated match to d1fkca_ |
PDB Entry: 3hak (more details), 1.8 Å
SCOPe Domain Sequences for d3haka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3haka_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyq
Timeline for d3haka_: