Lineage for d3h5ka_ (3h5k A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681140Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1681141Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1681142Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1681285Protein automated matches [190420] (8 species)
    not a true protein
  7. 1681371Species Phytolacca dioica [TaxId:29725] [188356] (6 PDB entries)
  8. 1681376Domain d3h5ka_: 3h5k A: [177199]
    automated match to d1gika_
    complexed with edo, nag

Details for d3h5ka_

PDB Entry: 3h5k (more details), 1.45 Å

PDB Description: crystal structure of the ribosome inactivating protein pdl1
PDB Compounds: (A:) Ribosome-inactivating protein PD-L1/PD-L2

SCOPe Domain Sequences for d3h5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h5ka_ d.165.1.1 (A:) automated matches {Phytolacca dioica [TaxId: 29725]}
intitydagnttinkyatfmeslrneakdpslqcygipmlpnnsstikyllvklqgasqk
titlmlrrnnlyvmgysdpfngncryhifnditgtertnventlcsssssrdakpinyns
lystlekkaevnsrsqvqlgiqilssdigkisgqssftdkteakfllvaiqmvseaarfk
yienqvktnfnrdfspndkildleenwgkistaihdatngalpkplelknadgtkwivlr
vdeikpdmgllnyvngtcqtt

SCOPe Domain Coordinates for d3h5ka_:

Click to download the PDB-style file with coordinates for d3h5ka_.
(The format of our PDB-style files is described here.)

Timeline for d3h5ka_: