SCOPe 2.08: Domain d3h5ka_: 3h5k A:

Lineage for d3h5ka_ (3h5k A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (9 species)
   not a true protein

7. Species Phytolacca dioica [TaxId:29725] [188356] (6 PDB entries)

8. Domain d3h5ka_: 3h5k A: [177199]
   automated match to d1gika_
   complexed with edo, nag

Details for d3h5ka_

PDB Entry: 3h5k, 1.45 Å

PDB Description: crystal structure of the ribosome inactivating protein pdl1

PDB Compounds: (A:) Ribosome-inactivating protein PD-L1/PD-L2

SCOPe Domain Sequences for d3h5ka_:

Sequence; same for both SEQRES and ATOM records:

>d3h5ka_ d.165.1.1 (A:) automated matches {Phytolacca dioica [TaxId: 29725]}
intitydagnttinkyatfmeslrneakdpslqcygipmlpnnsstikyllvklqgasqk
titlmlrrnnlyvmgysdpfngncryhifnditgtertnventlcsssssrdakpinyns
lystlekkaevnsrsqvqlgiqilssdigkisgqssftdkteakfllvaiqmvseaarfk
yienqvktnfnrdfspndkildleenwgkistaihdatngalpkplelknadgtkwivlr
vdeikpdmgllnyvngtcqtt

Timeline for d3h5ka_:

• d3h5ka_ first appeared in SCOPe 2.01
  
• d3h5ka_ appears in SCOPe 2.07