Lineage for d3d01f1 (3d01 F:10-164)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958881Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2958882Protein automated matches [190935] (24 species)
    not a true protein
  7. 2958883Species Agrobacterium tumefaciens [TaxId:176299] [188481] (1 PDB entry)
  8. 2958889Domain d3d01f1: 3d01 F:10-164 [173574]
    Other proteins in same PDB: d3d01a2, d3d01b2, d3d01c2, d3d01d2, d3d01e2, d3d01f2, d3d01g2, d3d01h2, d3d01i2, d3d01j2, d3d01k2, d3d01l2
    automated match to d2otma1
    complexed with pg5

Details for d3d01f1

PDB Entry: 3d01 (more details), 1.7 Å

PDB Description: Crystal structure of the protein Atu1372 with unknown function from Agrobacterium tumefaciens
PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d3d01f1:

Sequence, based on SEQRES records: (download)

>d3d01f1 d.79.1.0 (F:10-164) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
msdviegrlkelgftlpvaaapaanyvpftisgnllyvsgqlpmesgkiavtglvgrdvd
vasaqraaelcavnilaqvkaalngdlskirrviklngfvasvpefveqhlvingasnli
atvlgepgrharaavgmaslpfnasveidaiveid

Sequence, based on observed residues (ATOM records): (download)

>d3d01f1 d.79.1.0 (F:10-164) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
msdviegrlkelgftlpvanyvpftisgnllyvsgqlpmesgkiavtglvgrdvdvasaq
raaelcavnilaqvkaalngdlskirrviklngfvasvpefveqhlvingasnliatvlg
epgrharaavgmaslpfnasveidaiveid

SCOPe Domain Coordinates for d3d01f1:

Click to download the PDB-style file with coordinates for d3d01f1.
(The format of our PDB-style files is described here.)

Timeline for d3d01f1: