Lineage for d3d01f_ (3d01 F:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1032069Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1032070Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 1032250Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 1032251Protein automated matches [190935] (4 species)
    not a true protein
  7. 1032252Species Agrobacterium tumefaciens [TaxId:176299] [188481] (1 PDB entry)
  8. 1032258Domain d3d01f_: 3d01 F: [173574]
    automated match to d2otma1
    complexed with pg5

Details for d3d01f_

PDB Entry: 3d01 (more details), 1.7 Å

PDB Description: Crystal structure of the protein Atu1372 with unknown function from Agrobacterium tumefaciens
PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d3d01f_:

Sequence, based on SEQRES records: (download)

>d3d01f_ d.79.1.0 (F:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
tenlyfqgmsdviegrlkelgftlpvaaapaanyvpftisgnllyvsgqlpmesgkiavt
glvgrdvdvasaqraaelcavnilaqvkaalngdlskirrviklngfvasvpefveqhlv
ingasnliatvlgepgrharaavgmaslpfnasveidaiveid

Sequence, based on observed residues (ATOM records): (download)

>d3d01f_ d.79.1.0 (F:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
tenlyfqgmsdviegrlkelgftlpvanyvpftisgnllyvsgqlpmesgkiavtglvgr
dvdvasaqraaelcavnilaqvkaalngdlskirrviklngfvasvpefveqhlvingas
nliatvlgepgrharaavgmaslpfnasveidaiveid

SCOPe Domain Coordinates for d3d01f_:

Click to download the PDB-style file with coordinates for d3d01f_.
(The format of our PDB-style files is described here.)

Timeline for d3d01f_: