![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.1.0: automated matches [191544] (1 protein) not a true family |
![]() | Protein automated matches [190935] (24 species) not a true protein |
![]() | Species Agrobacterium tumefaciens [TaxId:176299] [188481] (1 PDB entry) |
![]() | Domain d3d01g1: 3d01 G:10-163 [173575] Other proteins in same PDB: d3d01a2, d3d01b2, d3d01c2, d3d01d2, d3d01e2, d3d01f2, d3d01g2, d3d01h2, d3d01i2, d3d01j2, d3d01k2, d3d01l2 automated match to d2otma1 complexed with pg5 |
PDB Entry: 3d01 (more details), 1.7 Å
SCOPe Domain Sequences for d3d01g1:
Sequence, based on SEQRES records: (download)
>d3d01g1 d.79.1.0 (G:10-163) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} msdviegrlkelgftlpvaaapaanyvpftisgnllyvsgqlpmesgkiavtglvgrdvd vasaqraaelcavnilaqvkaalngdlskirrviklngfvasvpefveqhlvingasnli atvlgepgrharaavgmaslpfnasveidaivei
>d3d01g1 d.79.1.0 (G:10-163) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} msdviegrlkelgftlpaanyvpftisgnllyvsgqlpmesgkiavtglvgrdvdvasaq raaelcavnilaqvkaalngdlskirrviklngfvasvpefveqhlvingasnliatvlg epgrharaavgmaslpfnasveidaivei
Timeline for d3d01g1: