SCOPe 2.08: Domain d3d01b1: 3d01 B:10-165

Lineage for d3d01b1 (3d01 B:10-165)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (4 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.0: automated matches [191544] (1 protein)
   not a true family

6. Protein automated matches [190935] (24 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [188481] (1 PDB entry)

8. Domain d3d01b1: 3d01 B:10-165 [173570]
   Other proteins in same PDB: d3d01a2, d3d01b2, d3d01c2, d3d01d2, d3d01e2, d3d01f2, d3d01g2, d3d01h2, d3d01i2, d3d01j2, d3d01k2, d3d01l2
   automated match to d2otma1
   complexed with pg5

Details for d3d01b1

PDB Entry: 3d01, 1.7 Å

PDB Description: Crystal structure of the protein Atu1372 with unknown function from Agrobacterium tumefaciens

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d3d01b1:

Sequence, based on SEQRES records:

>d3d01b1 d.79.1.0 (B:10-165) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
msdviegrlkelgftlpvaaapaanyvpftisgnllyvsgqlpmesgkiavtglvgrdvd
vasaqraaelcavnilaqvkaalngdlskirrviklngfvasvpefveqhlvingasnli
atvlgepgrharaavgmaslpfnasveidaiveidv

Sequence, based on observed residues (ATOM records):

>d3d01b1 d.79.1.0 (B:10-165) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
msdviegrlkelgftlpaanyvpftisgnllyvsgqlpmesgkiavtglvgrdvdvasaq
raaelcavnilaqvkaalngdlskirrviklngfvasvpefveqhlvingasnliatvlg
epgrharaavgmaslpfnasveidaiveidv

Timeline for d3d01b1:

• d3d01b1 first appeared in SCOPe 2.01, called d3d01b_
  
• d3d01b1 appears in SCOPe 2.07