Lineage for d3c63c_ (3c63 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311322Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2311323Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 2311324Protein Cytochrome b562 [47177] (1 species)
  7. 2311325Species Escherichia coli [TaxId:562] [47178] (44 PDB entries)
  8. 2311336Domain d3c63c_: 3c63 C: [173058]
    automated match to d1qq3a_
    complexed with ca, hem, zn

Details for d3c63c_

PDB Entry: 3c63 (more details), 1.75 Å

PDB Description: tetrameric cytochrome cb562 (k34/h59/d62/h63/h73/a74/h77) assembly stabilized by interprotein zinc coordination
PDB Compounds: (C:) Soluble cytochrome b562

SCOPe Domain Sequences for d3c63c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c63c_ a.24.3.1 (C:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmkaaaldaqkatppkledkspdspemhd
fdhgfdilvgqihaalhlanegkvkeaqaaaeqlkttcnachqkyr

SCOPe Domain Coordinates for d3c63c_:

Click to download the PDB-style file with coordinates for d3c63c_.
(The format of our PDB-style files is described here.)

Timeline for d3c63c_: