| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
| Family a.24.3.1: Cytochrome b562 [47176] (2 proteins) automatically mapped to Pfam PF07361 |
| Protein Cytochrome b562 [47177] (1 species) |
| Species Escherichia coli [TaxId:562] [47178] (75 PDB entries) |
| Domain d3c63b_: 3c63 B: [173057] automated match to d1qq3a_ complexed with ca, hem, zn |
PDB Entry: 3c63 (more details), 1.75 Å
SCOPe Domain Sequences for d3c63b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c63b_ a.24.3.1 (B:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmkaaaldaqkatppkledkspdspemhd
fdhgfdilvgqihaalhlanegkvkeaqaaaeqlkttcnachqkyr
Timeline for d3c63b_: