PDB entry 3c63

View 3c63 on RCSB PDB site
Description: Tetrameric Cytochrome cb562 (K34/H59/D62/H63/H73/A74/H77) Assembly Stabilized by Interprotein Zinc Coordination
Class: electron transport
Keywords: 16-helix bundle, interfacial Zn-coordination, Electron transport, Heme, Iron, Metal-binding, Transport
Deposited on 2008-02-02, released 2008-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.199
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (58)
      • engineered (61)
      • engineered (72-73)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3c63a_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (58)
      • engineered (61)
      • engineered (72-73)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3c63b_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (58)
      • engineered (61)
      • engineered (72-73)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3c63c_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (58)
      • engineered (61)
      • engineered (72-73)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3c63d_
  • Heterogens: ZN, CA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c63A (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmkaaaldaqkatppkledkspdspemhd
    fdhgfdilvgqihaalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c63B (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmkaaaldaqkatppkledkspdspemhd
    fdhgfdilvgqihaalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c63C (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmkaaaldaqkatppkledkspdspemhd
    fdhgfdilvgqihaalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c63D (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmkaaaldaqkatppkledkspdspemhd
    fdhgfdilvgqihaalhlanegkvkeaqaaaeqlkttcnachqkyr