SCOPe 2.04: Domain d3bwha_: 3bwh A:

Lineage for d3bwha_ (3bwh A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Cushaw squash (Cucurbita moschata) [TaxId:3662] [188622] (1 PDB entry)

8. Domain d3bwha_: 3bwh A: [172882]
   automated match to d1cf5a_
   complexed with edo, po4

Details for d3bwha_

PDB Entry: 3bwh, 1 Å

PDB Description: atomic resolution structure of cucurmosin, a novel type 1 rip from the sarcocarp of cucurbita moschata

PDB Compounds: (A:) cucurmosin

SCOPe Domain Sequences for d3bwha_:

Sequence; same for both SEQRES and ATOM records:

>d3bwha_ d.165.1.1 (A:) automated matches {Cushaw squash (Cucurbita moschata) [TaxId: 3662]}
nvrfdlssatsssyktfiknlrealpkdgkvydipvllstvmdsrrfilidlvnydgqsi
taaidvlnvyivaystgtvsyffqqvpaqapkllfkgtqqrtlpytgnyenlqtaakklr
enielglpaldsaittlfhynaeaaasallvliqttseaarfryielqiannvgtkfkps
qtiislennwsalskqiqiaknkngqfetpvilidpqgnrvqitnvtsnvvtqniqllln
igat

Timeline for d3bwha_:

• d3bwha_ first appeared in SCOPe 2.01
  
• d3bwha_ appears in SCOPe 2.03
  
• d3bwha_ appears in SCOPe 2.05
  
• d3bwha_ appears in the current release, SCOPe 2.08