Lineage for d3bwha_ (3bwh A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939585Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1939586Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1939587Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1939732Protein automated matches [190420] (8 species)
    not a true protein
  7. 1939747Species Cushaw squash (Cucurbita moschata) [TaxId:3662] [188622] (1 PDB entry)
  8. 1939748Domain d3bwha_: 3bwh A: [172882]
    automated match to d1cf5a_
    complexed with edo, po4

Details for d3bwha_

PDB Entry: 3bwh (more details), 1 Å

PDB Description: atomic resolution structure of cucurmosin, a novel type 1 rip from the sarcocarp of cucurbita moschata
PDB Compounds: (A:) cucurmosin

SCOPe Domain Sequences for d3bwha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bwha_ d.165.1.1 (A:) automated matches {Cushaw squash (Cucurbita moschata) [TaxId: 3662]}
nvrfdlssatsssyktfiknlrealpkdgkvydipvllstvmdsrrfilidlvnydgqsi
taaidvlnvyivaystgtvsyffqqvpaqapkllfkgtqqrtlpytgnyenlqtaakklr
enielglpaldsaittlfhynaeaaasallvliqttseaarfryielqiannvgtkfkps
qtiislennwsalskqiqiaknkngqfetpvilidpqgnrvqitnvtsnvvtqniqllln
igat

SCOPe Domain Coordinates for d3bwha_:

Click to download the PDB-style file with coordinates for d3bwha_.
(The format of our PDB-style files is described here.)

Timeline for d3bwha_: