Lineage for d1cf5a_ (1cf5 A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
contains mixed beta-sheetSuperfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) 
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) 
Protein Beta-momorcharin [56379] (1 species)
(almost) identical with the anti-tumor and anti-HIV-1 protein MAP30Species Bitter gourd (Momordica charantia) [TaxId:3673] [56380] (2 PDB entries) 
Domain d1cf5a_: 1cf5 A: [42191]
Details for d1cf5a_
PDB Entry: 1cf5 (more details), 2.55 Å
PDB Description: beta-momorcharin structure at 2.55 a
PDB Compounds: (A:) protein (beta-momorcharin)SCOPe Domain Sequences for d1cf5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cf5a_ d.165.1.1 (A:) Beta-momorcharin {Bitter gourd (Momordica charantia) [TaxId: 3673]}
dvnfdlstataktytkfiedfratlpfshkvydipllystisdsrrfillnltsyayeti
svaidvtnvyvvayrtrdvsyffkesppeaynilfkgtrkitlpytgnyenlqtaahkir
enidlglpalssaittlfyynaqsapsallvliqttaeaarfkyierhvakyvatnfkpn
laiislenqwsalskqiflaqnqggkfrnpvdlikptgqrfqvtnvdsdvvkgnikllln
srastaden
SCOPe Domain Coordinates for d1cf5a_:
Click to download the PDB-style file with coordinates for d1cf5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cf5a_:
- d1cf5a_ first appeared (with stable ids) in SCOP 1.55
- d1cf5a_ appears in SCOPe 2.03
- d1cf5a_ appears in SCOPe 2.05
- d1cf5a_ appears in the current release, SCOPe 2.08
View in 3D
