SCOPe 2.08: Domain d2sasa_: 2sas A:

Lineage for d2sasa_ (2sas A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Sarcoplasmic calcium-binding protein [47509] (2 species)

7. Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [47511] (1 PDB entry)

8. Domain d2sasa_: 2sas A: [17258]
   complexed with ca

Details for d2sasa_

PDB Entry: 2sas, 2.4 Å

PDB Description: structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 angstroms resolution

PDB Compounds: (A:) Sarcoplasmic calcium-binding protein

SCOPe Domain Sequences for d2sasa_:

Sequence; same for both SEQRES and ATOM records:

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
glndfqkqkikftfdffldmnhdgsiqdndfedmmtrykevnkgslsdadyksmqasled
ewrdlkgradinkddvvsweeylamwektiatcksvadlpawcqnripflfkgmdvsgdg
ivdleefqnycknfqlqcadvpavynvitdggkvtfdlnrykelyyrlltspaadagntl
mgqkp

Timeline for d2sasa_:

• d2sasa_ first appeared (with stable ids) in SCOP 1.55, called d2sas__
  
• d2sasa_ appears in SCOPe 2.07