Lineage for d2sas__ (2sas -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.5: Calmodulin-like [47502] (13 proteins) 
Protein Sarcoplasmic calcium-binding protein [47509] (2 species) 
Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [47511] (1 PDB entry) 
Domain d2sas__: 2sas - [17258]
Details for d2sas__
PDB Entry: 2sas (more details), 2.4 Å
PDB Description: structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 angstroms resolution
SCOP Domain Sequences for d2sas__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sas__ a.39.1.5 (-) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum)}
glndfqkqkikftfdffldmnhdgsiqdndfedmmtrykevnkgslsdadyksmqasled
ewrdlkgradinkddvvsweeylamwektiatcksvadlpawcqnripflfkgmdvsgdg
ivdleefqnycknfqlqcadvpavynvitdggkvtfdlnrykelyyrlltspaadagntl
mgqkp
SCOP Domain Coordinates for d2sas__:
Click to download the PDB-style file with coordinates for d2sas__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2sas__:
- d2sas__ appears in SCOP 1.57
- d2sas__ appears in the current release, SCOPe 2.08, called d2sasa_
View in 3D