PDB entry 2sas

View 2sas on RCSB PDB site
Description: structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 angstroms resolution
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1993-07-30, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sarcoplasmic calcium-binding protein
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2sasa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sasA (A:)
    glndfqkqkikftfdffldmnhdgsiqdndfedmmtrykevnkgslsdadyksmqasled
    ewrdlkgradinkddvvsweeylamwektiatcksvadlpawcqnripflfkgmdvsgdg
    ivdleefqnycknfqlqcadvpavynvitdggkvtfdlnrykelyyrlltspaadagntl
    mgqkp