Lineage for d3b78f1 (3b78 F:400-605)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000516Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. 3000517Species Pseudomonas aeruginosa [TaxId:287] [56407] (9 PDB entries)
  8. 3000532Domain d3b78f1: 3b78 F:400-605 [172453]
    Other proteins in same PDB: d3b78a1, d3b78a2, d3b78a3, d3b78a4, d3b78a5, d3b78b2, d3b78c1, d3b78c2, d3b78c3, d3b78c4, d3b78c5, d3b78d2, d3b78e1, d3b78e2, d3b78e3, d3b78e4, d3b78e5, d3b78f2
    automated match to d1aera_
    protein/RNA complex; complexed with nad

Details for d3b78f1

PDB Entry: 3b78 (more details), 2.5 Å

PDB Description: structure of the eef2-exoa(r551h)-nad+ complex
PDB Compounds: (F:) exotoxin a

SCOPe Domain Sequences for d3b78f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b78f1 d.166.1.1 (F:400-605) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
flgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrars
qdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltla
apeaageverlighplplrldaitgpeeegghletilgwplaertvvipsaiptdprnvg
gdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d3b78f1:

Click to download the PDB-style file with coordinates for d3b78f1.
(The format of our PDB-style files is described here.)

Timeline for d3b78f1: