Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
Protein Elongation factor 2 (eEF-2), domain IV [82575] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (13 PDB entries) Uniprot P32324 |
Domain d3b78c4: 3b78 C:561-725 [199038] Other proteins in same PDB: d3b78a1, d3b78a2, d3b78a3, d3b78a5, d3b78b1, d3b78b2, d3b78c1, d3b78c2, d3b78c3, d3b78c5, d3b78d1, d3b78d2, d3b78e1, d3b78e2, d3b78e3, d3b78e5, d3b78f1, d3b78f2 automated match to d1n0vc3 protein/RNA complex; complexed with nad has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3b78 (more details), 2.5 Å
SCOPe Domain Sequences for d3b78c4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b78c4 d.14.1.1 (C:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq
Timeline for d3b78c4:
View in 3D Domains from same chain: (mouse over for more information) d3b78c1, d3b78c2, d3b78c3, d3b78c5 |