Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) |
Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
Protein Elongation factor 2 (eEF-2), N-terminal domain [419042] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419527] (13 PDB entries) Uniprot P32324 |
Domain d3b78a3: 3b78 A:482-560 [199032] Other proteins in same PDB: d3b78a1, d3b78a2, d3b78a4, d3b78a5, d3b78b1, d3b78b2, d3b78c1, d3b78c2, d3b78c4, d3b78c5, d3b78d1, d3b78d2, d3b78e1, d3b78e2, d3b78e4, d3b78e5, d3b78f1, d3b78f2 automated match to d1n0vc4 protein/RNA complex; complexed with nad |
PDB Entry: 3b78 (more details), 2.5 Å
SCOPe Domain Sequences for d3b78a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b78a3 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2), N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic lqdlehdhagvplkisppv
Timeline for d3b78a3:
View in 3D Domains from same chain: (mouse over for more information) d3b78a1, d3b78a2, d3b78a4, d3b78a5 |