Lineage for d1aera_ (1aer A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. Species Pseudomonas aeruginosa [TaxId:287] [56407] (9 PDB entries)
  8. Domain d1aera_: 1aer A: [42249]
    complexed with amp, tad, tia

Details for d1aera_

PDB Entry: 1aer (more details), 2.3 Å

PDB Description: domain iii of pseudomonas aeruginosa exotoxin complexed with beta-tad
PDB Compounds: (A:) exotoxin a

SCOPe Domain Sequences for d1aera_:

Sequence, based on SEQRES records: (download)

>d1aera_ d.166.1.1 (A:) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpgkppr

Sequence, based on observed residues (ATOM records): (download)

>d1aera_ d.166.1.1 (A:) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvraa
iwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltlaapeaa
geverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnvggdldp
ssipdkeqaisalpdyasqpgkppr

SCOPe Domain Coordinates for d1aera_ are not available.

Timeline for d1aera_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aerb_