Lineage for d3b78e3 (3b78 E:482-560)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953474Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2953475Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2953505Protein Elongation factor 2 (eEF-2), N-terminal domain [419042] (2 species)
  7. 2953506Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419527] (13 PDB entries)
    Uniprot P32324
  8. 2953520Domain d3b78e3: 3b78 E:482-560 [199042]
    Other proteins in same PDB: d3b78a1, d3b78a2, d3b78a4, d3b78a5, d3b78b1, d3b78b2, d3b78c1, d3b78c2, d3b78c4, d3b78c5, d3b78d1, d3b78d2, d3b78e1, d3b78e2, d3b78e4, d3b78e5, d3b78f1, d3b78f2
    automated match to d1n0vc4
    protein/RNA complex; complexed with nad

Details for d3b78e3

PDB Entry: 3b78 (more details), 2.5 Å

PDB Description: structure of the eef2-exoa(r551h)-nad+ complex
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d3b78e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b78e3 d.58.11.1 (E:482-560) Elongation factor 2 (eEF-2), N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic
lqdlehdhagvplkisppv

SCOPe Domain Coordinates for d3b78e3:

Click to download the PDB-style file with coordinates for d3b78e3.
(The format of our PDB-style files is described here.)

Timeline for d3b78e3: