SCOPe 2.08: Domain d1au1b_: 1au1 B:

Lineage for d1au1b_ (1au1 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-beta [47309] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47310] (1 PDB entry)

8. Domain d1au1b_: 1au1 B: [16890]
   complexed with zn

Details for d1au1b_

PDB Entry: 1au1, 2.2 Å

PDB Description: human interferon-beta crystal structure

PDB Compounds: (B:) interferon-beta

SCOPe Domain Sequences for d1au1b_:

Sequence, based on SEQRES records:

>d1au1b_ a.26.1.3 (B:) Interferon-beta {Human (Homo sapiens) [TaxId: 9606]}
msynllgflqrssnfqcqkllwqlngrleyclkdrmnfdipeeikqlqqfqkedaaltiy
emlqnifaifrqdssstgwnetivenllanvyhqinhlktvleeklekedftrgklmssl
hlkryygrilhylkakeyshcawtivrveilrnfyfinrltgylrn

Sequence, based on observed residues (ATOM records):

>d1au1b_ a.26.1.3 (B:) Interferon-beta {Human (Homo sapiens) [TaxId: 9606]}
msynllgflqrssnfqcqkllwqlngrclkdrmnfdipeeikqlqqfqkedaaltiyeml
qnifaifrqdssstgwnetivenllanvyhqinhlktvleeklekedftrgklmsslhlk
ryygrilhylkakeyshcawtivrveilrnfyfinrltgylrn

Timeline for d1au1b_:

• d1au1b_ first appeared (with stable ids) in SCOP 1.55
  
• d1au1b_ appears in SCOPe 2.07