![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
![]() | Protein Interferon-beta [47309] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47310] (1 PDB entry) |
![]() | Domain d1au1b_: 1au1 B: [16890] complexed with zn |
PDB Entry: 1au1 (more details), 2.2 Å
SCOPe Domain Sequences for d1au1b_:
Sequence, based on SEQRES records: (download)
>d1au1b_ a.26.1.3 (B:) Interferon-beta {Human (Homo sapiens) [TaxId: 9606]} msynllgflqrssnfqcqkllwqlngrleyclkdrmnfdipeeikqlqqfqkedaaltiy emlqnifaifrqdssstgwnetivenllanvyhqinhlktvleeklekedftrgklmssl hlkryygrilhylkakeyshcawtivrveilrnfyfinrltgylrn
>d1au1b_ a.26.1.3 (B:) Interferon-beta {Human (Homo sapiens) [TaxId: 9606]} msynllgflqrssnfqcqkllwqlngrclkdrmnfdipeeikqlqqfqkedaaltiyeml qnifaifrqdssstgwnetivenllanvyhqinhlktvleeklekedftrgklmsslhlk ryygrilhylkakeyshcawtivrveilrnfyfinrltgylrn
Timeline for d1au1b_: