Lineage for d1au1b_ (1au1 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318696Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2318697Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2319033Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2319062Protein Interferon-beta [47309] (2 species)
  7. 2319063Species Human (Homo sapiens) [TaxId:9606] [47310] (1 PDB entry)
  8. 2319065Domain d1au1b_: 1au1 B: [16890]
    complexed with bgc, g6d, zn

Details for d1au1b_

PDB Entry: 1au1 (more details), 2.2 Å

PDB Description: human interferon-beta crystal structure
PDB Compounds: (B:) interferon-beta

SCOPe Domain Sequences for d1au1b_:

Sequence, based on SEQRES records: (download)

>d1au1b_ a.26.1.3 (B:) Interferon-beta {Human (Homo sapiens) [TaxId: 9606]}
msynllgflqrssnfqcqkllwqlngrleyclkdrmnfdipeeikqlqqfqkedaaltiy
emlqnifaifrqdssstgwnetivenllanvyhqinhlktvleeklekedftrgklmssl
hlkryygrilhylkakeyshcawtivrveilrnfyfinrltgylrn

Sequence, based on observed residues (ATOM records): (download)

>d1au1b_ a.26.1.3 (B:) Interferon-beta {Human (Homo sapiens) [TaxId: 9606]}
msynllgflqrssnfqcqkllwqlngrclkdrmnfdipeeikqlqqfqkedaaltiyeml
qnifaifrqdssstgwnetivenllanvyhqinhlktvleeklekedftrgklmsslhlk
ryygrilhylkakeyshcawtivrveilrnfyfinrltgylrn

SCOPe Domain Coordinates for d1au1b_:

Click to download the PDB-style file with coordinates for d1au1b_.
(The format of our PDB-style files is described here.)

Timeline for d1au1b_: