SCOP 1.63: Domain d2ilk__: 2ilk -

Lineage for d2ilk__ (2ilk -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglments of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (7 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
   intertwined dimer, similar to interferon-gamma

7. Species Human (Homo sapiens) [TaxId:9606] [47307] (5 PDB entries)

8. Domain d2ilk__: 2ilk - [16885]
   complexed with so4

Details for d2ilk__

PDB Entry: 2ilk, 1.6 Å

PDB Description: crystal structure of human interleukin-10 at 1.6 angstroms resolution

SCOP Domain Sequences for d2ilk__:

Sequence; same for both SEQRES and ATOM records:

>d2ilk__ a.26.1.3 (-) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens)}
tqsenscthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqal
semiqfyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvk
nafnklqekgiykamsefdifinyieaymtmkirn

Timeline for d2ilk__:

• d2ilk__ first appeared (with stable ids) in SCOP 1.55
  
• d2ilk__ appears in SCOP 1.61
  
• d2ilk__ appears in SCOP 1.65
  
• d2ilk__ appears in the current release, SCOPe 2.08, called d2ilka_