Lineage for d2ilk__ (2ilk -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2641Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 2642Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 2754Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (6 proteins)
  6. 2801Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (2 species)
  7. 2804Species Human (Homo sapiens) [TaxId:9606] [47307] (3 PDB entries)
  8. 2805Domain d2ilk__: 2ilk - [16885]

Details for d2ilk__

PDB Entry: 2ilk (more details), 1.6 Å

PDB Description: crystal structure of human interleukin-10 at 1.6 angstroms resolution

SCOP Domain Sequences for d2ilk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ilk__ a.26.1.3 (-) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens)}
tqsenscthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqal
semiqfyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvk
nafnklqekgiykamsefdifinyieaymtmkirn

SCOP Domain Coordinates for d2ilk__:

Click to download the PDB-style file with coordinates for d2ilk__.
(The format of our PDB-style files is described here.)

Timeline for d2ilk__: