Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
Protein automated matches [190531] (8 species) not a true protein |
Species Gloeobacter violaceus [TaxId:33072] [188397] (4 PDB entries) |
Domain d2vmld_: 2vml D: [168705] automated match to d1i7yb_ complexed with cyc |
PDB Entry: 2vml (more details), 2.4 Å
SCOPe Domain Sequences for d2vmld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vmld_ a.1.1.3 (D:) automated matches {Gloeobacter violaceus [TaxId: 33072]} mqdaftkaivaadlrgsflseqelnqltnlvkesnkrldavnaitgnaaeiisdaahklf aeqtdlirpggnaypnrrmaaclrdmeiilryvsyallagdasvledrclnglketyval gtptrsvaravqlmketaigyvnspsgvtrgdcsalvneaatyfdkaaasia
Timeline for d2vmld_: