| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
| Protein automated matches [190531] (8 species) not a true protein |
| Species Gloeobacter violaceus [TaxId:33072] [188397] (4 PDB entries) |
| Domain d2vmla_: 2vml A: [168702] automated match to d1i7ya_ complexed with cyc |
PDB Entry: 2vml (more details), 2.4 Å
SCOPe Domain Sequences for d2vmla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vmla_ a.1.1.3 (A:) automated matches {Gloeobacter violaceus [TaxId: 33072]}
mktviteviasadsqgrflnntelqaangrfqratasmeaaraltsnadslvkgavqevy
nkfpyltqpgqmgygdtnqakcardishylrfityslvaggtgplddyivaglrevnrtf
nlspswyiealkhikgkvgsqlsgqplteanayidycinals
Timeline for d2vmla_: