Lineage for d2vmlb_ (2vml B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1077042Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 1077200Protein automated matches [190531] (8 species)
    not a true protein
  7. 1077201Species Gloeobacter violaceus [TaxId:33072] [188397] (4 PDB entries)
  8. 1077207Domain d2vmlb_: 2vml B: [168703]
    automated match to d1i7yb_
    complexed with cyc

Details for d2vmlb_

PDB Entry: 2vml (more details), 2.4 Å

PDB Description: the monoclinic structure of phycocyanin from gloeobacter violaceus
PDB Compounds: (B:) phycocyanin beta chain

SCOPe Domain Sequences for d2vmlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vmlb_ a.1.1.3 (B:) automated matches {Gloeobacter violaceus [TaxId: 33072]}
mqdaftkaivaadlrgsflseqelnqltnlvkesnkrldavnaitgnaaeiisdaahklf
aeqtdlirpggnaypnrrmaaclrdmeiilryvsyallagdasvledrclnglketyval
gtptrsvaravqlmketaigyvnspsgvtrgdcsalvneaatyfdkaaasia

SCOPe Domain Coordinates for d2vmlb_:

Click to download the PDB-style file with coordinates for d2vmlb_.
(The format of our PDB-style files is described here.)

Timeline for d2vmlb_: