![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
![]() | Protein automated matches [190787] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries) |
![]() | Domain d2v9sb_: 2v9s B: [168409] automated match to d1w8aa_ complexed with gol, peg |
PDB Entry: 2v9s (more details), 2 Å
SCOPe Domain Sequences for d2v9sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v9sb_ c.10.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrridl snnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclrvda fqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtnpie tsgarctsprrlankrigqikskkfrc
Timeline for d2v9sb_: