PDB entry 2v9s

View 2v9s on RCSB PDB site
Description: Second LRR domain of human Slit2
Class: structural protein
Keywords: developmental protein, structural protein, neurogenesis, differentiation, egf-like domain
Deposited on 2007-08-25, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: slit homolog 2 protein n-product
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v9sa_
  • Chain 'B':
    Compound: slit homolog 2 protein n-product
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v9sb_
  • Chain 'C':
    Compound: slit homolog 2 protein n-product
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v9sc_
  • Chain 'D':
    Compound: slit homolog 2 protein n-product
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v9sd_
  • Heterogens: GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v9sA (A:)
    gslhcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrr
    idlsnnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclr
    vdafqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtn
    pietsgarctsprrlankrigqikskkfrcsaaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v9sA (A:)
    hcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrridl
    snnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclrvda
    fqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtnpie
    tsgarctsprrlankrigqikskkfrc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v9sB (B:)
    gslhcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrr
    idlsnnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclr
    vdafqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtn
    pietsgarctsprrlankrigqikskkfrcsaaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v9sB (B:)
    hcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrridl
    snnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclrvda
    fqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtnpie
    tsgarctsprrlankrigqikskkfrc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v9sC (C:)
    gslhcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrr
    idlsnnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclr
    vdafqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtn
    pietsgarctsprrlankrigqikskkfrcsaaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v9sC (C:)
    hcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrridl
    snnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclrvda
    fqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtnpie
    tsgarctsprrlankrigqikskkfrc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v9sD (D:)
    gslhcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrr
    idlsnnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclr
    vdafqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtn
    pietsgarctsprrlankrigqikskkfrcsaaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v9sD (D:)
    hcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrridl
    snnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclrvda
    fqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtnpie
    tsgarctsprrlankrigqikskkfrc