Lineage for d2v9sc_ (2v9s C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851922Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2851923Protein automated matches [190787] (14 species)
    not a true protein
  7. 2851937Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries)
  8. 2851948Domain d2v9sc_: 2v9s C: [168410]
    automated match to d1w8aa_
    complexed with gol, peg

Details for d2v9sc_

PDB Entry: 2v9s (more details), 2 Å

PDB Description: Second LRR domain of human Slit2
PDB Compounds: (C:) slit homolog 2 protein n-product

SCOPe Domain Sequences for d2v9sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9sc_ c.10.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrridl
snnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclrvda
fqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtnpie
tsgarctsprrlankrigqikskkfrc

SCOPe Domain Coordinates for d2v9sc_:

Click to download the PDB-style file with coordinates for d2v9sc_.
(The format of our PDB-style files is described here.)

Timeline for d2v9sc_: