Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins) applies to all domains of a family if the common domain is composed of a different number of small repeating units this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain |
Protein Slit [117461] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [117462] (1 PDB entry) Uniprot P24014 542-733 |
Domain d1w8aa_: 1w8a A: [114363] 3rd LRR domain applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1w8a (more details), 2.8 Å
SCOPe Domain Sequences for d1w8aa_:
Sequence, based on SEQRES records: (download)
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} dcpamchcegttvdctgrglkeiprdiplhttelllndnelgrissdglfgrlphlvkle lkrnqltgiepnafegashiqelqlgenkikeisnkmflglhqlktlnlydnqiscvmpg sfehlnsltslnlasnpfncnchlawfaewlrkkslnggaarcgapskvrdvqikdlphs efkcssensegc
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} dcpamchcegttvdctgrglkeiprdiplhttelllndnelgrissdglfgrlphlvkle lkrnqltgiepnafegashiqelqlgenkikeisnkmflglhqlktlnlydnqiscvmpg sfehlnsltslnlasnpfncnchlawfaewlrkkslnggaarcgapskvrdvqikdlphs efkcssegc
Timeline for d1w8aa_: