PDB entry 1w8a

View 1w8a on RCSB PDB site
Description: Third LRR domain of Drosophila Slit
Class: signaling protein
Keywords: signaling protein, secreted protein, axon guidance, leucine-rich repeat glycoprotein, egf-like domain, signal protein
Deposited on 2004-09-17, released 2004-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: slit protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8aa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w8aA (A:)
    dcpamchcegttvdctgrglkeiprdiplhttelllndnelgrissdglfgrlphlvkle
    lkrnqltgiepnafegashiqelqlgenkikeisnkmflglhqlktlnlydnqiscvmpg
    sfehlnsltslnlasnpfncnchlawfaewlrkkslnggaarcgapskvrdvqikdlphs
    efkcssensegc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8aA (A:)
    dcpamchcegttvdctgrglkeiprdiplhttelllndnelgrissdglfgrlphlvkle
    lkrnqltgiepnafegashiqelqlgenkikeisnkmflglhqlktlnlydnqiscvmpg
    sfehlnsltslnlasnpfncnchlawfaewlrkkslnggaarcgapskvrdvqikdlphs
    efkcssegc