SCOPe 2.08: Domain d1alua_: 1alu A:

Lineage for d1alua_ (1alu A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Interleukin-6 [47272] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47273] (9 PDB entries)

8. Domain d1alua_: 1alu A: [16826]
   complexed with so4, tla

Details for d1alua_

PDB Entry: 1alu, 1.9 Å

PDB Description: human interleukin-6

PDB Compounds: (A:) interleukin-6

SCOPe Domain Sequences for d1alua_:

Sequence, based on SEQRES records:

>d1alua_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Sequence, based on observed residues (ATOM records):

>d1alua_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
ltsseridkqiryildgisalrketcnksnmcenlnlpkmaekdgcfqsgfneetclvki
itgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpdpttnasl
ltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Timeline for d1alua_:

• d1alua_ first appeared (with stable ids) in SCOP 1.55, called d1alu__
  
• d1alua_ appears in SCOPe 2.07