PDB entry 1alu

View 1alu on RCSB PDB site
Description: human interleukin-6
Class: cytokine
Keywords: cytokine, interleukin, receptor, signaling, glycoprotein
Deposited on 1997-06-03, released 1998-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1alua_
  • Heterogens: SO4, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aluA (A:)
    mapvppgedskdvaaphrqpltsseridkqiryildgisalrketcnksnmcesskeala
    ennlnlpkmaekdgcfqsgfneetclvkiitgllefevyleylqnrfesseeqaravqms
    tkvliqflqkkaknldaittpdpttnaslltklqaqnqwlqdmtthlilrsfkeflqssl
    ralrqm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aluA (A:)
    ltsseridkqiryildgisalrketcnksnmcenlnlpkmaekdgcfqsgfneetclvki
    itgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpdpttnasl
    ltklqaqnqwlqdmtthlilrsfkeflqsslralrqm