Lineage for d1pgre_ (1pgr E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705449Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 2705456Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)
  7. 2705463Species Human (Homo sapiens) [TaxId:9606] [47269] (4 PDB entries)
  8. 2705471Domain d1pgre_: 1pgr E: [16819]
    Other proteins in same PDB: d1pgrb1, d1pgrb2, d1pgrd1, d1pgrd2, d1pgrf1, d1pgrf2, d1pgrh1, d1pgrh2

Details for d1pgre_

PDB Entry: 1pgr (more details), 3.5 Å

PDB Description: 2:2 complex of g-csf with its receptor
PDB Compounds: (E:) protein (granulocyte colony-stimulating factor)

SCOPe Domain Sequences for d1pgre_:

Sequence, based on SEQRES records: (download)

>d1pgre_ a.26.1.1 (E:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens) [TaxId: 9606]}
gpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplss
cpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmee
lgmapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp

Sequence, based on observed residues (ATOM records): (download)

>d1pgre_ a.26.1.1 (E:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens) [TaxId: 9606]}
gpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplss
cpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmee
lgmaampafasafqrraggvlvashlqsflevsyrvlrhlaqp

SCOPe Domain Coordinates for d1pgre_:

Click to download the PDB-style file with coordinates for d1pgre_.
(The format of our PDB-style files is described here.)

Timeline for d1pgre_: