Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries) |
Domain d1pgrb1: 1pgr B:1-106 [22045] Other proteins in same PDB: d1pgra_, d1pgrc_, d1pgre_, d1pgrg_ |
PDB Entry: 1pgr (more details), 3.5 Å
SCOPe Domain Sequences for d1pgrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pgrb1 b.1.2.1 (B:1-106) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdv
Timeline for d1pgrb1: