Lineage for d1pgrb1 (1pgr B:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761903Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species)
  7. 2761907Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries)
  8. 2761912Domain d1pgrb1: 1pgr B:1-106 [22045]
    Other proteins in same PDB: d1pgra_, d1pgrc_, d1pgre_, d1pgrg_

Details for d1pgrb1

PDB Entry: 1pgr (more details), 3.5 Å

PDB Description: 2:2 complex of g-csf with its receptor
PDB Compounds: (B:) protein (g-csf receptor)

SCOPe Domain Sequences for d1pgrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgrb1 b.1.2.1 (B:1-106) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}
agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdv

SCOPe Domain Coordinates for d1pgrb1:

Click to download the PDB-style file with coordinates for d1pgrb1.
(The format of our PDB-style files is described here.)

Timeline for d1pgrb1: