Lineage for d2rj2a_ (2rj2 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530854Family b.18.1.21: F-box associated region, FBA [101585] (2 proteins)
    automatically mapped to Pfam PF04300
  6. 1530859Protein automated matches [190275] (1 species)
    not a true protein
  7. 1530860Species Mouse (Mus musculus) [TaxId:10090] [187067] (2 PDB entries)
  8. 1530861Domain d2rj2a_: 2rj2 A: [168142]
    automated match to d1umha_
    complexed with cl, ni

Details for d2rj2a_

PDB Entry: 2rj2 (more details), 1.7 Å

PDB Description: Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution
PDB Compounds: (A:) F-box only protein 2

SCOPe Domain Sequences for d2rj2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rj2a_ b.18.1.21 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gshmfyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdgnveftqddsvkky
fassfewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsene
dvlaefatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnss
vwvep

SCOPe Domain Coordinates for d2rj2a_:

Click to download the PDB-style file with coordinates for d2rj2a_.
(The format of our PDB-style files is described here.)

Timeline for d2rj2a_: