SCOPe 2.08: Domain d2rj2a1: 2rj2 A:117-297

Lineage for d2rj2a1 (2rj2 A:117-297)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.21: F-box associated region, FBA [101585] (2 proteins)
   automatically mapped to Pfam PF04300

6. Protein automated matches [190275] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187067] (3 PDB entries)

8. Domain d2rj2a1: 2rj2 A:117-297 [168142]
   Other proteins in same PDB: d2rj2a2
   automated match to d1umha_
   complexed with cl, ni

Details for d2rj2a1

PDB Entry: 2rj2, 1.7 Å

PDB Description: Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution

PDB Compounds: (A:) F-box only protein 2

SCOPe Domain Sequences for d2rj2a1:

Sequence; same for both SEQRES and ATOM records:

>d2rj2a1 b.18.1.21 (A:117-297) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdgnveftqddsvkkyfass
fewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvla
efatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwve
p

Timeline for d2rj2a1:

• d2rj2a1 first appeared in SCOPe 2.01, called d2rj2a_
  
• d2rj2a1 appears in SCOPe 2.07