SCOPe 2.01: Domain d2rj2a_: 2rj2 A:

Lineage for d2rj2a_ (2rj2 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.21: F-box associated region, FBA [101585] (2 proteins)

6. Protein automated matches [190275] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187067] (2 PDB entries)

8. Domain d2rj2a_: 2rj2 A: [168142]
   automated match to d1umha_
   complexed with cl, ni

Details for d2rj2a_

PDB Entry: 2rj2, 1.7 Å

PDB Description: Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution

PDB Compounds: (A:) F-box only protein 2

SCOPe Domain Sequences for d2rj2a_:

Sequence; same for both SEQRES and ATOM records:

>d2rj2a_ b.18.1.21 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gshmfyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdgnveftqddsvkky
fassfewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsene
dvlaefatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnss
vwvep

Timeline for d2rj2a_:

• d2rj2a_ is new in SCOPe 2.01-stable
  
• d2rj2a_ appears in SCOPe 2.02
  
• d2rj2a_ appears in the current release, SCOPe 2.08, called d2rj2a1