Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.21: F-box associated region, FBA [101585] (2 proteins) automatically mapped to Pfam PF04300 |
Protein automated matches [190275] (1 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187067] (2 PDB entries) |
Domain d2rj2a_: 2rj2 A: [168142] automated match to d1umha_ complexed with cl, ni |
PDB Entry: 2rj2 (more details), 1.7 Å
SCOPe Domain Sequences for d2rj2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rj2a_ b.18.1.21 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gshmfyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdgnveftqddsvkky fassfewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsene dvlaefatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnss vwvep
Timeline for d2rj2a_: