Lineage for d1mmod_ (1mmo D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703338Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species)
  7. 2703339Species Methylococcus capsulatus [TaxId:414] [88790] (26 PDB entries)
  8. 2703386Domain d1mmod_: 1mmo D: [16770]
    Other proteins in same PDB: d1mmob_, d1mmoc_, d1mmog_, d1mmoh_
    complexed with acy, fe
    has additional subdomain(s) that are not in the common domain

Details for d1mmod_

PDB Entry: 1mmo (more details), 2.2 Å

PDB Description: crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane
PDB Compounds: (D:) methane monooxygenase hydrolase (alpha chain)

SCOPe Domain Sequences for d1mmod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmod_ a.25.1.2 (D:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]}
aanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavk
derqfgslqvaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqk
ngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfis
gdavecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtv
vsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwg
giwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfea
nypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgas
tlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgkt
liaqphvrgdklwtlddikrlncvfknpvkaf

SCOPe Domain Coordinates for d1mmod_:

Click to download the PDB-style file with coordinates for d1mmod_.
(The format of our PDB-style files is described here.)

Timeline for d1mmod_: