Lineage for d1mmod_ (1mmo D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2448Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 2449Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 2557Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 2566Protein Methane monooxygenase hydrolase, beta and alpha subunits [47254] (2 species)
  7. 2567Species Methylococcus capsulatus [TaxId:414] [47255] (10 PDB entries)
  8. 2598Domain d1mmod_: 1mmo D: [16770]
    Other proteins in same PDB: d1mmog_, d1mmoh_

Details for d1mmod_

PDB Entry: 1mmo (more details), 2.2 Å

PDB Description: crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane
PDB Compounds: (D:)

SCOP Domain Sequences for d1mmod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmod_ a.25.1.2 (D:) Methane monooxygenase hydrolase, beta and alpha subunits {Methylococcus capsulatus}
aanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavk
derqfgslqvaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqk
ngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfis
gdavecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtv
vsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwg
giwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfea
nypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgas
tlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgkt
liaqphvrgdklwtlddikrlncvfknpvkaf

SCOP Domain Coordinates for d1mmod_:

Click to download the PDB-style file with coordinates for d1mmod_.
(The format of our PDB-style files is described here.)

Timeline for d1mmod_: