Lineage for d2qard_ (2qar D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493398Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1493399Family a.60.1.1: Pointed domain [47770] (7 proteins)
  6. 1493409Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species)
  7. 1493410Species Escherichia coli [TaxId:562] [158525] (3 PDB entries)
  8. 1493413Domain d2qard_: 2qar D: [167499]
    Other proteins in same PDB: d2qarc_, d2qarf_
    automated match to d1ji7c_
    complexed with nh4, no3

Details for d2qard_

PDB Entry: 2qar (more details), 2.4 Å

PDB Description: structure of the 2tel crystallization module fused to t4 lysozyme with a helical linker.
PDB Compounds: (D:) E80-TELSAM domain

SCOPe Domain Sequences for d2qard_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qard_ a.60.1.1 (D:) Etv6 transcription factor pointed domain (Tel SAM) {Escherichia coli [TaxId: 562]}
asirlpahlrlqpiywsrddvaqwlkwaenefslspidsntfemngkalllltkedfryr
sphsgdelyellqhilkqrpgggg

SCOPe Domain Coordinates for d2qard_:

Click to download the PDB-style file with coordinates for d2qard_.
(The format of our PDB-style files is described here.)

Timeline for d2qard_: