SCOPe 2.04: Domain d2qarc_: 2qar C:

Lineage for d2qarc_ (2qar C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (546 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d2qarc_: 2qar C: [167498]
   Other proteins in same PDB: d2qara_, d2qarb_, d2qard_, d2qare_
   automated match to d139la_
   complexed with nh4, no3

Details for d2qarc_

PDB Entry: 2qar, 2.4 Å

PDB Description: structure of the 2tel crystallization module fused to t4 lysozyme with a helical linker.

PDB Compounds: (C:) lysozyme

SCOPe Domain Sequences for d2qarc_:

Sequence; same for both SEQRES and ATOM records:

>d2qarc_ d.2.1.3 (C:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
gpnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvit
kdeaeklfcqdvdaavrgilrnaklkpvydsldcvrrcalinmvfqmgetgvagftnslr
mlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d2qarc_:

• d2qarc_ first appeared in SCOPe 2.01
  
• d2qarc_ appears in SCOPe 2.03
  
• d2qarc_ appears in SCOPe 2.05
  
• d2qarc_ appears in the current release, SCOPe 2.08