Lineage for d2qarf_ (2qar F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1633243Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 1633249Protein Phage T4 lysozyme [53982] (1 species)
  7. 1633250Species Bacteriophage T4 [TaxId:10665] [53983] (546 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 1633812Domain d2qarf_: 2qar F: [167501]
    Other proteins in same PDB: d2qara_, d2qarb_, d2qard_, d2qare_
    automated match to d139la_
    complexed with nh4, no3

Details for d2qarf_

PDB Entry: 2qar (more details), 2.4 Å

PDB Description: structure of the 2tel crystallization module fused to t4 lysozyme with a helical linker.
PDB Compounds: (F:) lysozyme

SCOPe Domain Sequences for d2qarf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qarf_ d.2.1.3 (F:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
gpnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvit
kdeaeklfcqdvdaavrgilrnaklkpvydsldcvrrcalinmvfqmgetgvagftnslr
mlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d2qarf_:

Click to download the PDB-style file with coordinates for d2qarf_.
(The format of our PDB-style files is described here.)

Timeline for d2qarf_: